TFAP2D Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-13428
![Immunohistochemistry-Paraffin: TFAP2D Antibody [NBP2-13428]](https://resources.rndsystems.com/images/products/TFAP2D-Antibody-Immunohistochemistry-Paraffin-NBP2-13428-img0002.jpg "Immunohistochemistry-Paraffin: TFAP2D Antibody [NBP2-13428]")
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Predicted:
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: TPAICAALSTFQTVLSEMLNYLEKHTTHKNGGAADSGQGHANSEKAPLRKTSEAAVKEGK
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for TFAP2D Antibody - BSA Free
Immunohistochemistry-Paraffin: TFAP2D Antibody [NBP2-13428]
Immunohistochemistry-Paraffin: TFAP2D Antibody [NBP2-13428] - Staining of human cerebral cortex shows moderate nuclear and cytoplasmic positivity in neuronal cells.Applications for TFAP2D Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: TFAP2D
Alternate Names
Activating enhancer-binding protein 2-delta, AP-2 like, AP2-delta, TFAP2BL1activating enhancer binding protein 2 beta-like 1, transcription factor AP-2 beta (activating enhancer binding protein 2beta)-like 1, transcription factor AP-2 beta (activating enhancer-binding protein 2beta)-like 1, transcription factor AP-2 delta (activating enhancer binding protein 2 delta), Transcription factor AP-2-beta-like 1, transcription factor AP-2-delta
Gene Symbol
TFAP2D
Additional TFAP2D Products
Product Documents for TFAP2D Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for TFAP2D Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for TFAP2D Antibody - BSA Free
Powered by Bioz
Customer Reviews for TFAP2D Antibody - BSA Free
There are currently no reviews for this product. Be the first to review TFAP2D Antibody - BSA Free and earn rewards!
Have you used TFAP2D Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for TFAP2D Antibody - BSA Free
Showing
1
-
1 of
1 FAQ
Showing All
-
Q: Have any of your TFAP2 antibodies been tested for cross reactivity with the other TFAP2 proteins such as alpha, beta and epsilon? Have they been tested by immunostaining tissue?
A: A list of our TFAP2D antibodies can be found here. Our products are all guaranteed for the applications and species listed on the datasheet and are not expected to cross-react with any known proteins.
Loading...