TMC2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59417

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TMC2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to TMC2(transmembrane channel-like 2) The peptide sequence was selected from the middle region of TMC2. Peptide sequence YCWCWDLEAGFPSYAEFDISGNVLGLIFNQGMIWMGSFYAPGLVGINVLR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TMC2 Antibody - BSA Free

Western Blot: TMC2 Antibody [NBP1-59417]

Western Blot: TMC2 Antibody [NBP1-59417]

Western Blot: TMC2 Antibody [NBP1-59417] - Hela cell lysate, concentration 0.2-1 ug/ml.

Applications for TMC2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TMC2

TMC2 is considered a member of transmembrane proteins family. The specific function of this gene is unknown; however, expression in the inner ear suggests that it may be crucial for normal auditory function. This gene is considered a member of a gene family predicted to encode transmembrane proteins. The specific function of this gene is unknown; however, expression in the inner ear suggests that it may be crucial for normal auditory function. Mutations in this gene may underlie hereditary disorders of balance and hearing. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-382 AF417580.2 1-382 383-569 DA769512.1 96-282 570-859 DA769512.1 286-575 860-2736 AF417580.2 860-2736 2737-3169 AL049712.12 30165-30597 c

Alternate Names

C20orf145, dJ686C3.3, transmembrane channel-like 2, transmembrane channel-like protein 2, Transmembrane cochlear-expressed protein 2, transmembrane, cochlear expressed, 2

Gene Symbol

TMC2

UniProt

Q8TDI7 (Human)

Additional TMC2 Products

Product Documents for TMC2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TMC2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TMC2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TMC2 Antibody - BSA Free and earn rewards!

Have you used TMC2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies