TMEM166 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83678

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all TMEM166 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TMEM166. Peptide sequence: AALVIRISCHTDCRRRPGKKFLQDRESSSDSSDSEDGSEDTVSDLSVRRH The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TMEM166 Antibody - BSA Free

Western Blot: TMEM166 Antibody [NBP2-83678]

Western Blot: TMEM166 Antibody [NBP2-83678]

Western Blot: TMEM166 Antibody [NBP2-83678] - WB Suggested Anti-TMEM166 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: 293T cell lysate

Applications for TMEM166 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TMEM166

FUNCTION: Acts as a regulator of programmed cell death, mediating both autophagy and apoptosis. SUBCELLULAR LOCATION: Endoplasmic reticulum membrane; Single-pass membrane protein. Lysosome membrane; Single-pass membrane protein. TISSUE SPECIFICITY: Expressed in lung, kidney, liver, pancreas, placenta, but not in heart and skeletal muscle.

Alternate Names

family with sequence similarity 176, member A, TMEM166, Transmembrane protein 166FLJ13391

Gene Symbol

EVA1A

Additional TMEM166 Products

Product Documents for TMEM166 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TMEM166 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TMEM166 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TMEM166 Antibody - BSA Free and earn rewards!

Have you used TMEM166 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies