Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
TMPRSS4 Antibody is a synthetic peptides corresponding to TMPRSS4 (transmembrane protease, serine 4) The peptide sequence was selected from the middle region of TMPRSS4. Peptide sequence LSGSLVSLHCLACGKSLKTPRVVGGEEASVDSWPWQVSIQYDKQHVCGGS. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for TMPRSS4 Antibody - BSA Free
Western Blot: TMPRSS4 Antibody [NBP1-56991]
Western Blot: TMPRSS4 Antibody [NBP1-56991] - HepG2 cell lysate analyzed by Western blot at a concentration of 0.2-1 ug/ml. The observed molecular weight is represented by the band appearing at approximately 48 kDa.Western Blot: TMPRSS4 Antibody [NBP1-56991]
Western Blot: TMPRSS4 Antibody [NBP1-56991] - Human breast cancer cell line SKBR3 and Positive control. Image from verified customer review. The observed molecular weight is represented at the band appearing at 48 kDa.Applications for TMPRSS4 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Reviewed Applications
Read 1 review rated 5 using NBP1-56991 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: TMPRSS4
TMPRSS4 has also been shown to play a role in the process of viral entry for coronaviruses and influenza viruses thru proteolytic activation of key viral glycoproteins. One pathway for SARS-CoV-2 infection, which causes the COVID-19 disease, involves binding of the SARS-CoV-2 Spike 'S' glycoprotein to the human ACE2 receptor and cleavage of S by TMPRSS2 or potentially by TMPRSS4 at the cell surface to facilitate viral entry (3).
References
1. L de Aberasturi A, Calvo A. (2015) TMPRSS4: An Emerging Potential Therapeutic Target in Cancer. Br J Cancer. 112(1):4-8. PMID: 25203520
2. Zeng P., Zhang P., Zhou L., Tang M., Shen Y., Jin J., Zhu Y., Chen M. (2016) TMPRSS4 as an emerging potential poor prognostic factor for solid tumors: A systematic review and meta-analysis. Oncotarget. 7:76327-76336. PMID: 27344186
3. Zang F, Castro MFG, McCune BT, Zeng Q, Rothlauf PW, Sonnek NM, Liu Z, Brulois KF, Wang X, Greenberg HB, Diamond MS, Ciorba MA, Whelan SPJ, and Ding S. (2020) TMPRSS2 and TMPRSS4 promote SARS-CoV-2 infection of human small intestinal enterocytes. Sci Immunol. 5(47): eabc3582. PMID: 32404436
Long Name
Transmembrane protease, serine 4
Alternate Names
CAPH2, MT-SP2
Gene Symbol
TMPRSS4
UniProt
Additional TMPRSS4 Products
Product Documents for TMPRSS4 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for TMPRSS4 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for TMPRSS4 Antibody - BSA Free (1)
5 out of 5
1 Customer Rating
Have you used TMPRSS4 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Western BlotSample Tested: Human breast cancer cell line SKBR3 and Positive controlSpecies: HumanVerified Customer | Posted 08/15/2014TMPRSS4 NBP1-56991 western
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...