TNIP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79899

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TNIP1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen for this antibody is TNIP1. Peptide sequence: NSRLFHLPEYTWRLPCGGVRNPNQSSQVMDPPTARPTEPESPKNDREGPQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

70 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TNIP1 Antibody - BSA Free

Western Blot: TNIP1 Antibody [NBP1-79899]

Western Blot: TNIP1 Antibody [NBP1-79899]

Western Blot: TNIP1 Antibody [NBP1-79899] - Hela Cell Lysate 1ug/ml Gel Concentration 12%

Applications for TNIP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TNIP1

Interacts with zinc finger protein A20/TNFAIP3 and inhibits TNF-induced NF-kappa-B-dependent gene expression by interfering with an RIP- or TRAF2-mediated transactivation signal. Increases cell surface CD4(T4) antigen expression. Interacts with HIV-1 matrix protein and is packaged into virions and overexpression can inhibit viral replication. May regulate matrix nuclear localization, both nuclear import of PIC (Preintegration complex) and export of GAG polyprotein and viral genomic RNA during virion production

Alternate Names

ABIN-1, HIV-1 Nef-interacting protein, hVAN, KIAA0113nip40-1, Naf1, NAF1TNFAIP3-interacting protein 1, Nef-associated factor 1, Nef-associated factor 1 SNP, Nip40-1, TNFAIP3 interacting protein 1, VANvirion-associated nuclear-shuttling protein, Virion-associated nuclear shuttling protein

Gene Symbol

TNIP1

UniProt

NP_006049 (Human)

Additional TNIP1 Products

Product Documents for TNIP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TNIP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TNIP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TNIP1 Antibody - BSA Free and earn rewards!

Have you used TNIP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies