TP53INP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84309

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all TP53INP2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human TP53INP2. Peptide sequence: RLQRARQRAERHALSAKAVQRQNRARESRPRRSKNQSSFIYQPCQRQFNY The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TP53INP2 Antibody - BSA Free

Western Blot: TP53INP2 Antibody [NBP2-84309]

Western Blot: TP53INP2 Antibody [NBP2-84309]

Western Blot: TP53INP2 Antibody [NBP2-84309] - WB Suggested Anti-TP53INP2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human heart
Western Blot: TP53INP2 Antibody [NBP2-84309]

Western Blot: TP53INP2 Antibody [NBP2-84309]

Western Blot: TP53INP2 Antibody [NBP2-84309] - Host: Rabbit. Target Name: TP53INP2. Sample Tissue: Human A549 Whole Cell. Antibody Dilution: 1ug/ml

Applications for TP53INP2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TP53INP2

TP53INP2 (tumor protein p53 inducible nuclear protein 2) participates in the regulation of transcription and autophagy. TP53INP2 is known to have interactions with GABARAPL2, MAP1LC3A and GABARAP. TP53INP2 has been studied in relation to obesity, ataxia and achalasia.

Alternate Names

C20orf110, chromosome 20 open reading frame 110, diabetes and obesity regulated, dJ1181N3.1, DKFZp434B2411, DKFZp434O0827, DOR, FLJ21759, FLJ23500, p53-inducible protein U, PINHPIG-U, tumor protein p53 inducible nuclear protein 2, tumor protein p53-inducible nuclear protein 2

Gene Symbol

TP53INP2

Additional TP53INP2 Products

Product Documents for TP53INP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TP53INP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TP53INP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TP53INP2 Antibody - BSA Free and earn rewards!

Have you used TP53INP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies