TRA2B Antibody (7A1) - Azide and BSA Free

Novus Biologicals | Catalog # H00006434-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA, Sandwich ELISA, Knockdown Validated

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 7A1

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

SFRS10 (NP_004584, 120 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRP

Specificity

SFRS10 (7A1)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for TRA2B Antibody (7A1) - Azide and BSA Free

Western Blot: TRA2B Antibody (7A1) [H00006434-M01]

Western Blot: TRA2B Antibody (7A1) [H00006434-M01]

Western Blot: TRA2B Antibody (7A1) [H00006434-M01] - Analysis of SFRS10 expression in transfected 293T cell line by SFRS10 monoclonal antibody (M01), clone 7A1.Lane 1: SFRS10 transfected lysate(33.7 KDa).Lane 2: Non-transfected lysate.
Western Blot: TRA2B Antibody (7A1) [H00006434-M01]

Western Blot: TRA2B Antibody (7A1) [H00006434-M01]

Western Blot: TRA2B Antibody (7A1) [H00006434-M01] - Analysis of SFRS10 over-expressed 293 cell line, cotransfected with SFRS10 Validated Chimera RNAi ( Cat # H00006434-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SFRS10 monoclonal antibody (M01), clone 7A1 (Cat # H00006434-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Sandwich ELISA: TRA2B Antibody (7A1) [H00006434-M01] - Detection limit for recombinant GST tagged SFRS10 is approximately 0.1ng/ml as a capture antibody.

Applications for TRA2B Antibody (7A1) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Knockdown Validated

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for RNAi Validation and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: TRA2B

Sequence-specific RNA-binding protein which participates in the control of pre-mRNA splicing

Alternate Names

DKFZp686F18120, hTRA2-beta, SFRS10, Splicing factor, arginine/serine-rich 10, splicing factor, arginine/serine-rich 10 (transformer 2 homolog, Drosophila), SRFS10, TRA-2 beta, TRA2-BETA, TRAN2B, transformer 2 beta homolog (Drosophila), transformer 2 homolog, Transformer-2 protein homolog B, transformer-2 protein homolog beta, transformer-2-beta

Entrez Gene IDs

6434 (Human)

Gene Symbol

TRA2B

OMIM

602719 (Human)

Additional TRA2B Products

Product Documents for TRA2B Antibody (7A1) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TRA2B Antibody (7A1) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for TRA2B Antibody (7A1) - Azide and BSA Free

Customer Reviews for TRA2B Antibody (7A1) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review TRA2B Antibody (7A1) - Azide and BSA Free and earn rewards!

Have you used TRA2B Antibody (7A1) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...