Trace Amine Receptor 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88451

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Trace Amine Receptor 1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human Trace Amine Receptor 1. Peptide sequence: NDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNWLIHSMATVD The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Trace Amine Receptor 1 Antibody - BSA Free

Western Blot: Trace Amine Receptor 1 Antibody [NBP2-88451]

Western Blot: Trace Amine Receptor 1 Antibody [NBP2-88451]

Western Blot: Trace Amine Receptor 1 Antibody [NBP2-88451] - Host: Rabbit. Target Name: TAAR1. Sample Tissue: Human Stomach Tumor. Antibody Dilution: 1.0ug/ml

Applications for Trace Amine Receptor 1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Trace Amine Receptor 1

TA1 (Trace amine receptor 1) is a member of the G protein coupled receptor family (subfamily trace amine). It is activated by endogenous trace amines as well as metabolites of the biogenic amine neurotransmitters. Trace amines are biogenic amines present in very low levels in mammalian tissues. Although some trace amines have clearly defined roles as neurotransmitters in invertebrates, the extent to which they function as true neurotransmitters in vertebrates has remained speculative. Trace amines are likely to be involved in a variety of physiological functions that have yet to be fully understood. This receptor is mediated by the G(s)-class of G-proteins which activate adenylate cyclase. TA1 has been reported in human brain, dorsal root ganglion, olfactory bulb, kidney, liver, lung, pancreas, prostate, skeletal muscle, small intestine, spleen, spinal cord, and stomach. An EST for TA1 has been identified from a human stomach cancer library.

Long Name

Trace amine-associated receptor 1

Alternate Names

TAAR1, TaR-1, TAR1, TRAR1

Gene Symbol

TAAR1

Additional Trace Amine Receptor 1 Products

Product Documents for Trace Amine Receptor 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Trace Amine Receptor 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Trace Amine Receptor 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Trace Amine Receptor 1 Antibody - BSA Free and earn rewards!

Have you used Trace Amine Receptor 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies