Trappin-2/Elafin/Skalp Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-62538

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Trappin-2/Elafin Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PI3(peptidase inhibitor 3, skin-derived (SKALP)) The peptide sequence was selected form the middle region of PI3. Peptide sequence KGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAM. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Trappin-2/Elafin/Skalp Antibody - BSA Free

Western Blot: Trappin-2/Elafin/Skalp Antibody [NBP1-62538]

Western Blot: Trappin-2/Elafin/Skalp Antibody [NBP1-62538]

Western Blot: Skalp Antibody [NBP1-62538] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Applications for Trappin-2/Elafin/Skalp Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Trappin-2/Elafin

PI3 is an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria. PI3 contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. PI3 belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines.This gene encodes an elastase-specific inhibitor, which contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

Elastase Inhibitor, Transglutaminase Substrate, Serine Protease

Alternate Names

Elafin, ESI, PI3, SKALP, Trappin2

Gene Symbol

PI3

OMIM

NP_002629 (Human)

UniProt

P19957

Additional Trappin-2/Elafin Products

Product Documents for Trappin-2/Elafin/Skalp Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Trappin-2/Elafin/Skalp Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Serine Proteases and Regulators

Customer Reviews for Trappin-2/Elafin/Skalp Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Trappin-2/Elafin/Skalp Antibody - BSA Free and earn rewards!

Have you used Trappin-2/Elafin/Skalp Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies