TREML2/TLT-2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-70737

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TREML2/TLT-2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to TREML2(triggering receptor expressed on myeloid cells-like 2) The peptide sequence was selected from the middle region of TREML2. Peptide sequence TGYSFTATSTTSQGPRRTMGSQTVTASPSNARDSSAGPESISTKSGDLST. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TREML2/TLT-2 Antibody - BSA Free

Western Blot: TREML2/TLT-2 Antibody [NBP1-70737]

Western Blot: TREML2/TLT-2 Antibody [NBP1-70737]

Western Blot: TREML2/TLT-2 Antibody [NBP1-70737] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Applications for TREML2/TLT-2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TREML2/TLT-2

TREML2 is a single-pass type I membrane protein, and it contains 1 Ig-like V-type (immunoglobulin-like) domain. TREML2 is a cell surface receptor that may play a role in the innate and adaptive immune response. TREML2 is located in a gene cluster on chromosome 6 with the single Ig variable (IgV) domain activating receptors TREM1 (MIM 605085) and TREM2 (MIM 605086), but it has distinct structural and functional properties (Allcock et al., 2003 [PubMed 12645956]).[supplied by OMIM]. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1294 AY358171.1 2-1295 1295-3758 AL133404.8 7920-10383

Long Name

Triggering Receptor Expressed on Myeloid Cells-like 2

Alternate Names

TLT2

Gene Symbol

TREML2

Additional TREML2/TLT-2 Products

Product Documents for TREML2/TLT-2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TREML2/TLT-2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TREML2/TLT-2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TREML2/TLT-2 Antibody - BSA Free and earn rewards!

Have you used TREML2/TLT-2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies