TRF-1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57285

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TRF-1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FLSKLQHGTQQQDLNKKERRVGTLQSTKKKKESRRATESRIPVSKSQPVTPE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TRF-1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TRF-1 Antibody [NBP2-57285]

Immunocytochemistry/ Immunofluorescence: TRF-1 Antibody [NBP2-57285]

Immunocytochemistry/Immunofluorescence: TRF-1 Antibody [NBP2-57285] - Staining of human cell line U-2 OS shows localization to nuclear bodies & nucleoli fibrillar center. Antibody staining is shown in green.
TRF-1 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: TRF-1 Antibody - BSA Free [NBP2-57285]

Chromatin Immunoprecipitation-exo-Seq: TRF-1 Antibody - BSA Free [NBP2-57285]

ChIP-Exo-Seq composite graph for Anti-TERF1 (NBP2-57285) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for TRF-1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRF-1

Telomeric repeat binding factor 1 (TRF1, TERF1, PIN2, TRBF1) and telomeric repeat binding factor 2 (TRF2, TERF2, TRBF2) are present at telomeres throughout the cell cycle, where they regulate telomerase by acting in cis to limit the elongation of individual chromosome ends. Telomerase adds hexameric repeats of TTAGGG to the ends of chromosomal DNA. This telomerase enzyme plays an influential role in cellular immortalization and cellular senescence. TRF1 negatively regulates telomere elongation, while TRF2 protects the chromosome ends by inhibiting end-to-end fusions. Downregulation of TRF expression in tumor cells may contribute to cell immortalization and malignant progression. TRF1 has an acidic N-terminus while TRF2 has a basic N-terminus. TRF2 localizes in the nucleolus at G0 and S and diffuses out of the nucleolus in G2 phase. During mitosis TRF2 disperses from the condensed chromosomes and returns to the nucleolus at cytokinesis.

Long Name

Telomeric Repeat Binding Factor

Alternate Names

PIN-2, TERF1, TRF1

Gene Symbol

TERF1

Additional TRF-1 Products

Product Documents for TRF-1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TRF-1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TRF-1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TRF-1 Antibody - BSA Free and earn rewards!

Have you used TRF-1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies