Troponin I type 2 (fast skeletal) Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57842

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Troponin I type 2 (fast skeletal) Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to Troponin I type 2 (fast skeletal) The peptide sequence was selected from the N terminal of Troponin I type 2 (fast skeletal). Peptide sequence PLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Troponin I type 2 (fast skeletal) Antibody - BSA Free

Western Blot: Troponin I type 2 (fast skeletal) Antibody [NBP1-57842]

Western Blot: Troponin I type 2 (fast skeletal) Antibody [NBP1-57842]

Western Blot: Troponin I type 2 (fast skeletal) Antibody [NBP1-57842] - Human Muscle lysate, concentration 1.25ug/ml.

Applications for Troponin I type 2 (fast skeletal) Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Troponin I type 2 (fast skeletal)

Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.

Alternate Names

skeletal, fast, troponin I type 2 (skeletal, fast), troponin I, fast skeletal muscle, Troponin I, fast-twitch isoform, troponin I, fast-twitch skeletal muscle isoform

Gene Symbol

TNNI2

UniProt

P48788 (Human)

Additional Troponin I type 2 (fast skeletal) Products

Product Documents for Troponin I type 2 (fast skeletal) Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Troponin I type 2 (fast skeletal) Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Troponin I type 2 (fast skeletal) Antibody - BSA Free

Customer Reviews for Troponin I type 2 (fast skeletal) Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Troponin I type 2 (fast skeletal) Antibody - BSA Free and earn rewards!

Have you used Troponin I type 2 (fast skeletal) Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies