Troponin T Type 3 (fast skeletal) Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56340

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Troponin T Type 3 (fast skeletal) Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human TNNT3 (NP_001036245). Peptide sequence QLEIDKFEFGEKLKRQKYDIMNVRARVQMLAKFSKKAGTPAKGKVGGRWK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Troponin T Type 3 (fast skeletal) Antibody - BSA Free

Western Blot: Troponin T Type 3 (fast skeletal) Antibody [NBP1-56340]

Western Blot: Troponin T Type 3 (fast skeletal) Antibody [NBP1-56340]

Western Blot: Troponin T Type 3 (fast skeletal) Antibody [NBP1-56340] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Applications for Troponin T Type 3 (fast skeletal) Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Troponin T Type 3 (fast skeletal)

Troponin T is the tropomyosin-binding subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.

Alternate Names

Beta-TnTF, fast skeletal muscle, TnTf, troponin T type 3 (skeletal, fast), troponin T3, skeletal, fast, troponin-T3, skeletal, fast

Entrez Gene IDs

7140 (Rat)

Gene Symbol

TNNT3

UniProt

P45378 (Human)

Additional Troponin T Type 3 (fast skeletal) Products

Product Documents for Troponin T Type 3 (fast skeletal) Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Troponin T Type 3 (fast skeletal) Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Troponin T Type 3 (fast skeletal) Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Troponin T Type 3 (fast skeletal) Antibody - BSA Free and earn rewards!

Have you used Troponin T Type 3 (fast skeletal) Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies