TRPM4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88492

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human TRPM4. Peptide sequence: ELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TRPM4 Antibody - BSA Free

Western Blot: TRPM4 Antibody [NBP2-88492]

Western Blot: TRPM4 Antibody [NBP2-88492]

Western Blot: TRPM4 Antibody [NBP2-88492] - Host: Rabbit. Target Name: TRPM4. Sample Type: 293T. Antibody Dilution: 1.0ug/ml
Western Blot: TRPM4 Antibody [NBP2-88492]

Western Blot: TRPM4 Antibody [NBP2-88492]

Western Blot: TRPM4 Antibody [NBP2-88492] - WB Suggested Anti-TRPM4 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: 293T cell lysate
Western Blot: TRPM4 Antibody [NBP2-88492]

Western Blot: TRPM4 Antibody [NBP2-88492]

Western Blot: TRPM4 Antibody [NBP2-88492] - Host: Rabbit. Target Name: TRPM4. Sample Type: HepG2. Antibody Dilution: 1.0ug/ml
Western Blot: TRPM4 Antibody [NBP2-88492]

Western Blot: TRPM4 Antibody [NBP2-88492]

Western Blot: TRPM4 Antibody [NBP2-88492] - Host: Rabbit. Target Name: TRPM4. Sample Type: Jurkat. Antibody Dilution: 1.0ug/ml
Western Blot: TRPM4 Antibody [NBP2-88492]

Western Blot: TRPM4 Antibody [NBP2-88492]

Western Blot: TRPM4 Antibody [NBP2-88492] - Host: Rat. Target Name: TRPM4. Sample Tissue: Rat Brain. Antibody Dilution: 1ug/ml

Applications for TRPM4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRPM4

FUNCTION: Calcium-activated non selective (CAN) cation channel that mediates membrane depolarization. While it is activated by increase in intracellular Ca(2+), it is impermeable to it. Mediates transport of monovalent cations (Na(+) > K(+) > Cs(+) > Li(+)), leading to depolarize the membrane. It thereby plays a central role in cadiomyocytes, neurons from entorhinal cortex, dorsal root and vomeronasal neurons, endocrine pancreas cells, kidney epithelial cells, cochlea hair cells etc. Participates in T-cell activation by modulating Ca(2+) oscillations after T lymphocyte activation, which is required for NFAT-dependent IL2 production. Involved in myogenic constriction of cerebral arteries. Controls insulin secretion in pancreatic beta-cells. May also be involved in pacemaking or could cause irregular electrical activity under conditions of Ca(2+) overload.; ENZYME REGULATION: Gating is voltage-dependent and repressed by decavanadate. Calmodulin-binding confers the Ca(2+) sensitivity. ATP is able to restore Ca(2+) sensitivity after desensitization. Phosphatidylinositol 4,5-biphosphate (PIP2)-binding strongly enhances activity, by increasing the channel's Ca(2+) sensitivity and shifting its voltage dependence of activation towards negative potentials. Activity is also enhanced by 3,5-bis(trifluoromethyl)pyrazole derivative (BTP2). SUBUNIT: Homomultimer. SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein. TISSUE SPECIFICITY: Widely expressed with a high expression in intestine and prostate. In brain, it is both expressed in whole cerebral arteries and isolated vascular smooth muscle cells.

Long Name

Transient receptor potential cation channel subfamily M member 4

Alternate Names

hTRPM4, LTrpC-4, LTrpC4, Melastatin-4

Gene Symbol

TRPM4

Additional TRPM4 Products

Product Documents for TRPM4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TRPM4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TRPM4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TRPM4 Antibody - BSA Free and earn rewards!

Have you used TRPM4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...