Trypsin 2/PRSS2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86879

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Trypsin 2/PRSS2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Trypsin 2/PRSS2. Peptide sequence: EGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Trypsin 2/PRSS2 Antibody - BSA Free

Western Blot: Trypsin 2/PRSS2 Antibody [NBP2-86879]

Western Blot: Trypsin 2/PRSS2 Antibody [NBP2-86879]

Western Blot: Trypsin 2/PRSS2 Antibody [NBP2-86879] - Host: Rabbit. Target Name: PRSS2. Sample Tissue: Human Stomach Tumor lysates. Antibody Dilution: 1ug/ml

Applications for Trypsin 2/PRSS2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Trypsin 2/PRSS2

PRSS2 encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is secreted by the pancreas and cleaved to its active form in the small intestine. It is active on peptide linkages involving the carboxyl group of lysine or arginine. This gene and several other trypsinogen genes are localized to the T cell receptor beta locus on chromosome 7. [provided by RefSeq]

Alternate Names

PRSS2, Tesp4, TRY8, Trypsinogen 20

Gene Symbol

PRSS2

Additional Trypsin 2/PRSS2 Products

Product Documents for Trypsin 2/PRSS2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Trypsin 2/PRSS2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Trypsin 2/PRSS2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Trypsin 2/PRSS2 Antibody - BSA Free and earn rewards!

Have you used Trypsin 2/PRSS2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies