Trypsin 3/PRSS3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57036

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Trypsin 3/PRSS3 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PRSS3 (protease, serine, 3) The peptide sequence was selected from the N terminal of PRSS3. Peptide sequence VAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAH. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Trypsin 3/PRSS3 Antibody - BSA Free

Western Blot: Trypsin 3/PRSS3 Antibody [NBP1-57036]

Western Blot: Trypsin 3/PRSS3 Antibody [NBP1-57036]

Western Blot: Trypsin 3/PRSS3 Antibody [NBP1-57036] - Human Muscle lysate, concentration 0.2-1 ug/ml.
Western Blot: Trypsin 3/PRSS3 Antibody [NBP1-57036]

Western Blot: Trypsin 3/PRSS3 Antibody [NBP1-57036]

Western Blot: Trypsin 3/PRSS3 Antibody [NBP1-57036] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Applications for Trypsin 3/PRSS3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Trypsin 3/PRSS3

This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is expressed in the brain and pancreas and is resistant to common trypsin inhibitors. It is active on peptide linkages involving the carboxyl group of lysine or arginine. This gene is localized to the locus of T cell receptor beta variable orphans on chromosome 9. Four transcript variants encoding different isoforms have been described for this gene.

Alternate Names

Mesotrypsin, MTG, PRSS3, PRSS4, Trypsin 4, Trypsinogen 15

Gene Symbol

PRSS3

UniProt

P35030 (Human)

Additional Trypsin 3/PRSS3 Products

Product Documents for Trypsin 3/PRSS3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Trypsin 3/PRSS3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Serine Proteases and Regulators

Customer Reviews for Trypsin 3/PRSS3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Trypsin 3/PRSS3 Antibody - BSA Free and earn rewards!

Have you used Trypsin 3/PRSS3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies