Tryptase beta-2/TPSB2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88496

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Tryptase beta-2/TPSB2. Peptide sequence: QALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Tryptase beta-2/TPSB2 Antibody - BSA Free

Western Blot: Tryptase beta-2/TPSB2 Antibody [NBP2-88496]

Western Blot: Tryptase beta-2/TPSB2 Antibody [NBP2-88496]

Western Blot: Tryptase beta-2/TPSB2 Antibody [NBP2-88496] - Host: Rabbit. Target Name: TPSB2. Sample Type: HT1080 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for Tryptase beta-2/TPSB2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Tryptase beta-2/TPSB2

Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes are clustered on chromosome 16p13.3. These genes are characterized by several distinct features. They have a highly conserved 3' UTR and contain tandem repeat sequences at the 5' flank and 3' UTR which are thought to play a role in regulation of the mRNA stability. These genes have an intron immediately upstream of the initiator Met codon, which separates the site of transcription initiation from protein coding sequence. This feature is characteristic of tryptases but is unusual in other genes. The alleles of this gene exhibit an unusual amount of sequence variation, such that the alleles were once thought to represent two separate genes, beta II and beta III. Beta tryptases appear to be the main isoenzymes expressed in mast cells, whereas in basophils, alpha-tryptases predominate. Tryptases have been implicated as mediators in the pathogenesis of asthma and other allergic and inflammatory disorders. [provided by RefSeq]

Alternate Names

EC 3.4.21, EC 3.4.21.59, mast cell tryptase beta II, mast cell tryptase beta III, TPS2, TPS2tryptase beta-2, TPSB2, tryptase beta 2, tryptase beta 2 (gene/pseudogene), tryptase beta II, tryptase beta III, Tryptase beta2, Tryptase beta-2, Tryptase II, tryptase III, tryptase-2, tryptaseB, tryptaseC, Tryptase-C

Gene Symbol

TPSB2

Additional Tryptase beta-2/TPSB2 Products

Product Documents for Tryptase beta-2/TPSB2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Tryptase beta-2/TPSB2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Tryptase beta-2/TPSB2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Tryptase beta-2/TPSB2 Antibody - BSA Free and earn rewards!

Have you used Tryptase beta-2/TPSB2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...