TSC22/TSC22D1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-54941

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QYGQQQPMVSTQMAPGHVKSVTQNPASEYVQQQPILQTAMSSGQPSSAGVGAGTTVIPVAQPQGIQLPVQPTAVPAQPAGASVQP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TSC22/TSC22D1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TSC22/TSC22D1 Antibody [NBP2-54941]

Immunocytochemistry/ Immunofluorescence: TSC22/TSC22D1 Antibody [NBP2-54941]

Immunocytochemistry/Immunofluorescence: TSC22/TSC22D1 Antibody [NBP2-54941] - Staining of human cell line A549 shows localization to nucleoplasm.
TSC22/TSC22D1 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: TSC22/TSC22D1 Antibody - BSA Free [NBP2-54941]

Chromatin Immunoprecipitation-exo-Seq: TSC22/TSC22D1 Antibody - BSA Free [NBP2-54941]

ChIP-Exo-Seq composite graph for Anti-TSC22D1 (NBP2-54941) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for TSC22/TSC22D1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TSC22

Transforming growth factor-beta-stimulated clone-22 (TSC-22) acts as a transcriptionalregulator to modulate cell growth and differentiation and cell death. TSC-22 contains a leucine zipper domain as well as a nuclear export signal, resulting in cytoplasmic localization in living cells. However, concomitant with the induction of apoptosis, TSC-22 translocates from the cytoplasm to the nucleus and shows transcriptional regulatory activity. TSC-22 acts as a major downstream component in the TGF-beta pathway, and also the PPARgamma signalling pathway. The association of these two pathways with tumor suppression, and the significant downregulation of TSC-22 mRNA in various cancer types, such as brain and salivary gland tumors, imply an antiproliferative role for TSC-22.

Long Name

TSC22 Domain Family, Member 1

Alternate Names

Egr5, TGFB1I4, TSC22D1

Gene Symbol

TSC22D1

Additional TSC22 Products

Product Documents for TSC22/TSC22D1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TSC22/TSC22D1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TSC22/TSC22D1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TSC22/TSC22D1 Antibody - BSA Free and earn rewards!

Have you used TSC22/TSC22D1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...