TZFP Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79984

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TZFP Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human ZBTB32. Peptide sequence PIRLPSPYGSDRLVQLAARLRPALCDTLITVGSQEFPAHSLVLAGVSQQL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TZFP Antibody - BSA Free

Western Blot: TZFP Antibody [NBP1-79984]

Western Blot: TZFP Antibody [NBP1-79984]

Western Blot: TZFP Antibody [NBP1-79984] - Host: Rabbit. Target Name: WT1. Sample Type: 721_B. Antibody Dilution: 1.0ug/mlZBTB32 is supported by BioGPS gene expression data to be expressed in 721_B
Western Blot: TZFP Antibody [NBP1-79984]

Western Blot: TZFP Antibody [NBP1-79984]

Western Blot: TZFP Antibody [NBP1-79984] - Human 721_B.
Western Blot: TZFP Antibody [NBP1-79984]

Western Blot: TZFP Antibody [NBP1-79984]

Western Blot: TZFP Antibody [NBP1-79984] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: TZFP Antibody [NBP1-79984]

Western Blot: TZFP Antibody [NBP1-79984]

Western Blot: TZFP Antibody [NBP1-79984] - Host: Rabbit. Target Name: ZBTB32. Sample Tissue: Human DLD1 Whole Cell. Antibody Dilution: 1ug/ml

Applications for TZFP Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TZFP

DNA-binding protein that binds to the to a 5'-TGTACAGTGT-3' core sequence. May function as a transcriptional transactivator and transcriptional repressor. Probably exerts its repressor effect by preventing GATA3 from binding to DNA. May play a role in regulating the differentiation and activation of helper T cells

Alternate Names

Fanconi anemia zinc finger protein, FAXF, FAZFFANCC-interacting protein, ROG, Testis zinc finger protein, TZFPZinc finger protein 538, zinc finger and BTB domain containing 32, zinc finger and BTB domain-containing protein 32, ZNF538FAXFrepressor of GATA

Gene Symbol

ZBTB32

Additional TZFP Products

Product Documents for TZFP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TZFP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TZFP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TZFP Antibody - BSA Free and earn rewards!

Have you used TZFP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies