UBE2Z Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88536

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all UBE2Z Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of UBE2Z. Peptide sequence: GEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for UBE2Z Antibody - BSA Free

Western Blot: UBE2Z Antibody [NBP2-88536]

Western Blot: UBE2Z Antibody [NBP2-88536]

Western Blot: UBE2Z Antibody [NBP2-88536] - Host: Rabbit. Target Name: UBE2Z. Sample Type: Human 721_B. Antibody Dilution: 1.0ug/mlUBE2Z is supported by BioGPS gene expression data to be expressed in 721_B
Western Blot: UBE2Z Antibody [NBP2-88536]

Western Blot: UBE2Z Antibody [NBP2-88536]

Western Blot: UBE2Z Antibody [NBP2-88536] - WB Suggested Anti-UBE2Z Antibody. Titration: 1.0 ug/ml. Positive Control: HepG2 Whole Cell
Western Blot: UBE2Z Antibody [NBP2-88536]

Western Blot: UBE2Z Antibody [NBP2-88536]

Western Blot: UBE2Z Antibody [NBP2-88536] - Host: Rabbit. Target Name: UBE2Z. Sample Type: Human MCF7. Antibody Dilution: 1.0ug/mlUBE2Z is supported by BioGPS gene expression data to be expressed in MCF7

Applications for UBE2Z Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UBE2Z

Modification of proteins with ubiquitin (UBB; MIM 191339) or ubiquitin-like proteins controls many signaling networksand requires a ubiquitin activating enzyme (E1), a ubiquitin conjugating enzyme (E2), and a ubiquitin protein ligase(E3). UBE2Z is an E2 enzyme (Jin et al., 2007 (PubMed 17597759)).(supplied by OMIM)

Alternate Names

EC 6.3.2.19, FLJ13855, Uba6-specific E2 conjugating enzyme 1, UBA6-specific enzyme E2, Ubiquitin carrier protein Z, ubiquitin-conjugating enzyme E2 Z, ubiquitin-conjugating enzyme E2Z, Ubiquitin-protein ligase Z, Use1

Gene Symbol

UBE2Z

Additional UBE2Z Products

Product Documents for UBE2Z Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for UBE2Z Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UBE2Z Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UBE2Z Antibody - BSA Free and earn rewards!

Have you used UBE2Z Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies