Ubiquitin B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98436

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen for this antibody is ubiquitin B - N-terminal region. Peptide sequence KEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Ubiquitin B Antibody - BSA Free

Western Blot: Ubiquitin B Antibody [NBP1-98436]

Western Blot: Ubiquitin B Antibody [NBP1-98436]

Western Blot: Ubiquitin B Antibody [NBP1-98436] - Lane 1: C2C12 lysate Lane 2: C2C12 lysate with 1uM MG132. Primary Antibody Dilution: 1:500. Secondary Antibody: Anti-rabbit-HRP. Secondary Antibody Dilution: 1:3000. Gene Name: Ubb. Submitted by: Anonymous
Western Blot: Ubiquitin B Antibody [NBP1-98436]

Western Blot: Ubiquitin B Antibody [NBP1-98436]

Western Blot: Ubiquitin B Antibody [NBP1-98436] - Mouse Pancreas Lysate 1.0ug/ml, Gel Concentration: 12%

Applications for Ubiquitin B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ubiquitin+1

ubiquitin B encodes ubiquitin, one of the most conserved proteins known. Ubiquitin is required for ATP-dependent, nonlysosomal intracellular protein degradation of abnormal proteins and normal proteins with a rapid turnover. Ubiquitin is covalently bound to proteins to be degraded, and presumably labels these proteins for degradation. Ubiquitin also binds to histone H2A in actively transcribed regions but does not cause histone H2A degradation, suggesting that ubiquitin is also involved in regulation of gene expression. This gene consists of three direct repeats of the ubiquitin coding sequence with no spacer sequence. Consequently, the protein is expressed as a polyubiquitin precursor with a final amino acid after the last repeat. Aberrant form of this protein has been noticed in patients with Alzheimer's and Down syndrome.

Long Name

frame shift mutant

Alternate Names

FLJ25987, MGC8385, polyubiquitin B, polyubiquitin-B, RPS27A, UBA52, UBC, ubiquitin B

Gene Symbol

UBB

Additional Ubiquitin+1 Products

Product Documents for Ubiquitin B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Ubiquitin B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Ubiquitin B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Ubiquitin B Antibody - BSA Free and earn rewards!

Have you used Ubiquitin B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...