UGT1A6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49113

Novus Biologicals
Discontinued Product
NBP2-49113 has been discontinued. View all UGT1A6 products.

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all UGT1A6 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: WLSMKDIVEVLSDRGHEIVVVVPEVNLLLKESKYYTRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIGLY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for UGT1A6 Antibody - BSA Free

Immunohistochemistry-Paraffin: UGT1A6 Antibody [NBP2-49113]

Immunohistochemistry-Paraffin: UGT1A6 Antibody [NBP2-49113]

Immunohistochemistry-Paraffin: UGT1A6 Antibody [NBP2-49113] - Staining of human urinary bladder shows high expression.
Immunohistochemistry: UGT1A6 Antibody [NBP2-49113]

Immunohistochemistry: UGT1A6 Antibody [NBP2-49113]

Immunohistochemistry: UGT1A6 Antibody [NBP2-49113] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: UGT1A6 Antibody [NBP2-49113]

Immunohistochemistry-Paraffin: UGT1A6 Antibody [NBP2-49113]

Immunohistochemistry-Paraffin: UGT1A6 Antibody [NBP2-49113] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: UGT1A6 Antibody [NBP2-49113]

Immunohistochemistry-Paraffin: UGT1A6 Antibody [NBP2-49113]

Immunohistochemistry-Paraffin: UGT1A6 Antibody [NBP2-49113] - Staining in human urinary bladder and endometrium tissues using anti-UGT1A6 antibody. Corresponding UGT1A6 RNA-seq data are presented for the same tissues.

Applications for UGT1A6 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UGT1A6

UGT1A6 encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene is active on phenolic and planar compounds. Alternative splicing in the unique 5' end of this gene results in two transcript variants.

Alternate Names

GNT1UDPGT 1-6, HLUGP, HLUGP1, MGC29860, Phenol-metabolizing UDP-glucuronosyltransferase, UDP glucuronosyltransferase 1 family, polypeptide A6, UDP glycosyltransferase 1 family, polypeptide A6, UDP-glucuronosyltransferase 1 family polypeptide A6s, UDP-glucuronosyltransferase 1-6, UDP-glucuronosyltransferase 1A6, UDP-glucuronosyltransferase 1-F, UDPGT, UGT1, UGT1*6, UGT1.6, UGT1-06, UGT1A6S, UGT-1F, UGT1FEC 2.4.1.17

Gene Symbol

UGT1A6

Additional UGT1A6 Products

Product Documents for UGT1A6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for UGT1A6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UGT1A6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UGT1A6 Antibody - BSA Free and earn rewards!

Have you used UGT1A6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies