UNC13D/Munc 13-4 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-57967
![Immunocytochemistry/ Immunofluorescence: UNC13D/Munc 13-4 Antibody [NBP2-57967]](https://beta-resources.rndsystems.com/images/products/UNC13D-Munc-13-4-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-57967-img0002.jpg "Immunocytochemistry/ Immunofluorescence: UNC13D/Munc 13-4 Antibody [NBP2-57967]")
Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TEWFHLKQQHHQPMVQGIPEAGKALLGLVQDVIGDLHQCQRTWDKIFHNTLKIHLFSMAFRELQWLVAKRVQDHTTVVGDVV
Reactivity Notes
Mouse 80%, Rat 82%
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
Novus Biologicals Rabbit UNC13D/Munc 13-4 Antibody - BSA Free (NBP2-57967) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for UNC13D/Munc 13-4 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: UNC13D/Munc 13-4 Antibody [NBP2-57967]
Immunocytochemistry/Immunofluorescence: UNC13D/Munc 13-4 Antibody [NBP2-57967] - Staining of human cell line SH-SY5Y shows localization to cytosol & vesicles.Applications for UNC13D/Munc 13-4 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: UNC13D
Long Name
UNC-13 Homolog D
Alternate Names
FHL3, HLH3, HPLH3, Munc13-4
Gene Symbol
UNC13D
Additional UNC13D Products
Product Documents for UNC13D/Munc 13-4 Antibody - BSA Free
Product Specific Notices for UNC13D/Munc 13-4 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for UNC13D/Munc 13-4 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review UNC13D/Munc 13-4 Antibody - BSA Free and earn rewards!
Have you used UNC13D/Munc 13-4 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for UNC13D/Munc 13-4 Antibody - BSA Free
Showing
1
-
1 of
1 FAQ
Showing All
-
A: Unfortunately we do not epitope map our antibodies, but we do have a whole list of antibodies against your target depending on species reactivity and application you want to use them for. Please see this link to our MUNC 13-4 antibodies. All of the immunogen information that is not proprietary, or known should be presented on the datasheet. Often times a range will be provided where the peptide falls within, or if it was raised against a larger recombinant protein as is the case for the one you inquired about we do not know exactly where the binding occurs.
Loading...