UQCRQ Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86043

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all UQCRQ Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human UQCRQ. Peptide sequence: KGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for UQCRQ Antibody - BSA Free

Western Blot: UQCRQ Antibody [NBP2-86043]

Western Blot: UQCRQ Antibody [NBP2-86043]

Western Blot: UQCRQ Antibody [NBP2-86043] - Host: Rabbit. Target Name: UQCRQ. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml
Western Blot: UQCRQ Antibody [NBP2-86043]

Western Blot: UQCRQ Antibody [NBP2-86043]

Western Blot: UQCRQ Antibody [NBP2-86043] - WB Suggested Anti-UQCRQ Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Liver
Western Blot: UQCRQ Antibody [NBP2-86043]

Western Blot: UQCRQ Antibody [NBP2-86043]

Western Blot: UQCRQ Antibody [NBP2-86043] - Host: Rabbit. Target Name: UQCRQ. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml
Western Blot: UQCRQ Antibody [NBP2-86043]

Western Blot: UQCRQ Antibody [NBP2-86043]

Western Blot: UQCRQ Antibody [NBP2-86043] - Host: Rabbit. Target Name: UQCRQ. Sample Type: Human Fetal Brain. Antibody Dilution: 1.0ug/ml
Western Blot: UQCRQ Antibody [NBP2-86043]

Western Blot: UQCRQ Antibody [NBP2-86043]

Western Blot: UQCRQ Antibody [NBP2-86043] - Host: Rabbit. Target Name: UQCRQ. Sample Type: Human Fetal Kidney. Antibody Dilution: 1.0ug/ml
Western Blot: UQCRQ Antibody [NBP2-86043]

Western Blot: UQCRQ Antibody [NBP2-86043]

Western Blot: UQCRQ Antibody [NBP2-86043] - Host: Rabbit. Target Name: UQCRQ. Sample Type: Human Hela. Antibody Dilution: 1.0ug/mlUQCRQ is supported by BioGPS gene expression data to be expressed in HeLa
Western Blot: UQCRQ Antibody [NBP2-86043]

Western Blot: UQCRQ Antibody [NBP2-86043]

Western Blot: UQCRQ Antibody [NBP2-86043] - Host: Rabbit. Target Name: UQCRQ. Sample Type: Human 721_B. Antibody Dilution: 1.0ug/mlUQCRQ is supported by BioGPS gene expression data to be expressed in 721_B
Western Blot: UQCRQ Antibody [NBP2-86043]

Western Blot: UQCRQ Antibody [NBP2-86043]

Western Blot: UQCRQ Antibody [NBP2-86043] - Host: Rabbit. Target Name: UQCRQ. Sample Type: Human MCF7. Antibody Dilution: 1.0ug/mlUQCRQ is supported by BioGPS gene expression data to be expressed in MCF7
Immunoprecipitation: UQCRQ Antibody [NBP2-86043]

Immunoprecipitation: UQCRQ Antibody [NBP2-86043]

Immunoprecipitation: UQCRQ Antibody [NBP2-86043] - UQCRQ was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with with 1:200 dilution. Western blot was performed using NBP2-86043 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: UQCRQ IP in HEK293 Whole Cell Lysate. Lane 3: Input of HEK293 Whole Cell Lysate.

Applications for UQCRQ Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UQCRQ

The UQCRQ gene encodes a ubiquinone-binding protein of low molecular mass. This protein is a small core-associated protein and a subunit of ubiquinol-cytochrome c reductase complex III, which is part of the mitochondrial respiratory chain. (provided by RefSeq)

Alternate Names

complex III subunit 8, cytochrome b-c1 complex subunit 8, low molecular mass ubiquinone-binding protein (9.5kD), QPC, ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C, ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa, UQCR7

Gene Symbol

UQCRQ

Additional UQCRQ Products

Product Documents for UQCRQ Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for UQCRQ Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UQCRQ Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UQCRQ Antibody - BSA Free and earn rewards!

Have you used UQCRQ Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies