UQCRQ Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-93506

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all UQCRQ Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-82 of human UQCRQ (NP_055217.2). MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for UQCRQ Antibody - BSA Free

Western Blot: UQCRQ AntibodyBSA Free [NBP2-93506]

Western Blot: UQCRQ AntibodyBSA Free [NBP2-93506]

Western Blot: UQCRQ Antibody [NBP2-93506] - Western blot analysis of extracts of various cell lines, using UQCRQ Rabbit pAb (NBP2-93506) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Applications for UQCRQ Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: UQCRQ

The UQCRQ gene encodes a ubiquinone-binding protein of low molecular mass. This protein is a small core-associated protein and a subunit of ubiquinol-cytochrome c reductase complex III, which is part of the mitochondrial respiratory chain. (provided by RefSeq)

Alternate Names

complex III subunit 8, cytochrome b-c1 complex subunit 8, low molecular mass ubiquinone-binding protein (9.5kD), QPC, ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C, ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa, UQCR7

Gene Symbol

UQCRQ

Additional UQCRQ Products

Product Documents for UQCRQ Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for UQCRQ Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UQCRQ Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UQCRQ Antibody - BSA Free and earn rewards!

Have you used UQCRQ Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies