USAG1/SOSTDC1 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-03287

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all USAG1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 115-206 of human USAG1/SOSTDC1 (NP_056279.1). GGGYGTKYWSRRSSQEWRCVNDKTRTQRIQLQCQDGSTRTYKITVVTACKCKRYTRQHNESSHNFESMSPAKPVQHHRERKRASKSSKHSMS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for USAG1/SOSTDC1 Antibody - Azide and BSA Free

Western Blot: USAG1/SOSTDC1 AntibodyAzide and BSA Free [NBP3-03287]

Western Blot: USAG1/SOSTDC1 AntibodyAzide and BSA Free [NBP3-03287]

Western Blot: USAG1/SOSTDC1 Antibody [NBP3-03287] - Analysis of extracts of various cell lines, using USAG1/SOSTDC1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.

Applications for USAG1/SOSTDC1 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: USAG1

SOSTDC1 is a member of the sclerostin family and encodes an N-glycosylated, secreted protein with a C-terminal cystine knot-like domain. This protein functions as a bone morphogenetic protein (BMP) antagonist. Specifically, it directly associates with BMPs, prohibiting them from binding their receptors, thereby regulating BMP signaling during cellular proliferation, differentiation, and programmed cell death. [provided by RefSeq]

Long Name

Sclerostin Domain Containing Protein 1/Uterine Sensitization-associated Gene 1 Protein

Alternate Names

CDA019, Ectodin, SOSTDC1, WISE

Gene Symbol

SOSTDC1

Additional USAG1 Products

Product Documents for USAG1/SOSTDC1 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for USAG1/SOSTDC1 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for USAG1/SOSTDC1 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review USAG1/SOSTDC1 Antibody - Azide and BSA Free and earn rewards!

Have you used USAG1/SOSTDC1 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies