USP22 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82941

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (96%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all USP22 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MVSRPEPEGEAMDAELAVAPPGCSHLGSFKVDNWKQNLRAIYQCF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for USP22 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: USP22 Antibody [NBP1-82941]

Immunocytochemistry/ Immunofluorescence: USP22 Antibody [NBP1-82941]

Immunocytochemistry/Immunofluorescence: USP22 Antibody [NBP1-82941] - Staining of human cell line U-251 MG shows localization to nuclear speckles. Antibody staining is shown in green.
USP22 Antibody - BSA Free Chromatin Immunoprecipitation ChIP: USP22 Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: USP22 Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-USP22 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for USP22 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: USP22

Histone deubiquitinating component of the transcription regulatory histone acetylation (HAT) complex SAGA. Catalyzes the deubiquitination of both histones H2A and H2B, thereby acting as a coactivator. Recruited to specific gene promoters by activators such as MYC, where it is required for transcription. Required for nuclear receptor-mediated transactivation and cell cycle progression

Long Name

Ubiquitin Specific Protease 22

Alternate Names

Ubiquitin Thioesterase 22, USP3L

Entrez Gene IDs

23326 (Human)

Gene Symbol

USP22

UniProt

Q9UPT9

Additional USP22 Products

Product Documents for USP22 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for USP22 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Deubiquitinating Enzymes (DUBs)

Customer Reviews for USP22 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review USP22 Antibody - BSA Free and earn rewards!

Have you used USP22 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies