USP46 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-82293
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Predicted:
Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Cited:
Western Blot, Immunoprecipitation, Chemotaxis
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LFDNYMQQDAHEFLNYLLNTIADILQEEKKQEKQNGKLKNGNMNEPAENNKPELTWVHEIFQGTLTNETRCLNCETVSSKDEDFLDLSVDVEQN
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for USP46 Antibody - BSA Free
Western Blot: USP46 Antibody [NBP1-82293]
USP46-Antibody-Western-Blot-NBP1-82293-img0004.jpgImmunohistochemistry-Paraffin: USP46 Antibody [NBP1-82293]
Immunohistochemistry-Paraffin: USP46 Antibody [NBP1-82293] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.Immunohistochemistry-Paraffin: USP46 Antibody [NBP1-82293] -
Immunohistochemistry-Paraffin: USP46 Antibody [NBP1-82293] -Staining of human Cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.Immunohistochemistry-Paraffin: USP46 Antibody [NBP1-82293] -
Immunohistochemistry-Paraffin: USP46 Antibody [NBP1-82293] - Staining of human Skeletal muscle shows moderate cytoplasmic positivity in myocytes.Immunohistochemistry-Paraffin: USP46 Antibody [NBP1-82293] -
Immunohistochemistry-Paraffin: USP46 Antibody [NBP1-82293] -Staining of human Liver shows very weak cytoplasmic positivity in hepatocytes.Western Blot: USP46 Antibody [NBP1-82293] -
ChIP assay for WDR48 at the p14ARF promoter.Chromatin immunoprecipitation (ChIP) assays were performed using antibodies for WDR48 (A) from EBNA3C-HT LCLs that were grown in the presence of 4HT (dark gray) or after 14 days of growth in the absence of 4HT (light gray). Amount of genomic DNA was measured by real time PCR using primers specific to the EBNA3C binding site in the p14ARF promoters or sites near the EIF2AK3 & PPIA genes which bind cell transcription factors but not EBNA3C. The bar graph represents the amount of DNA precipitated relative to the amount of DNA in the corresponding input sample. The experiment shown is representative of four independent experiments & error bars indicating standard error of the mean within this experiment. Asterisk denotes that the difference in ChIP signal seen at the p14ARF promoter is statistically significant (p = 0.01). (B) Western blot for USP46, WDR48, & tubulin levels in whole cell lysates from EBNA3CHT LCLs grown in the presence of 4HT or after 14 days of growth in the absence of 4HT. Image collected & cropped by CiteAb from the following publication (https://dx.plos.org/10.1371/journal.ppat.1004822), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: USP46 Antibody [NBP1-82293] -
Western Blot: USP46 Antibody [NBP1-82293] - Purified EBNA3 complexes exhibit DUB activity.(A) Tandem affinity purification was performed on wild type or EBNA3-F-HA expressing LCLs. Purified complexes from wild type (X), E3A-F-HA (closed circle), E3B-F-HA (closed triangle), or E3C-F-HA (closed square) LCLs were assayed for DUB activity by fluorometric assay using Ub-AMC as a substrate. (B) Western blot of purified EBNA3 complexes used in (A) demonstrating selective precipitation of tagged EBNA3 protein complexes & co-purification of RBPJ & USP46 proteins. Lysates derived from the equivalent of approximately 1.5x106 cells (input), 2.4x106 cells (Flag elution), or 10x106 cells (HA elution) were loaded on each lane, separated by SDS PAGE, & probed with EBNA3s, Flag, EBNA3A, & HA antibodies. Image collected & cropped by CiteAb from the following publication (https://dx.plos.org/10.1371/journal.ppat.1004822), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for USP46 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: USP46
Long Name
Ubiquitin Specific Protease 46
Alternate Names
Deubiquitinating enzyme 46, EC 3.1.2.15, EC 3.4.19.12, FLJ11850, FLJ12552, FLJ14283, FLJ39393, ubiquitin carboxyl-terminal hydrolase 46, ubiquitin specific peptidase 46, ubiquitin specific protease 46, ubiquitin thioesterase 46, Ubiquitin thiolesterase 46, Ubiquitin-specific-processing protease 46
Entrez Gene IDs
64854 (Human)
Gene Symbol
USP46
UniProt
Additional USP46 Products
Product Documents for USP46 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for USP46 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for USP46 Antibody - BSA Free
Customer Reviews for USP46 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review USP46 Antibody - BSA Free and earn rewards!
Have you used USP46 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...