USP48 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59752

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all USP48 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to USP48(ubiquitin specific peptidase 48) The peptide sequence was selected from the middle region of USP48. Peptide sequence ALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for USP48 Antibody - BSA Free

Western Blot: USP48 Antibody [NBP1-59752]

Western Blot: USP48 Antibody [NBP1-59752]

Western Blot: USP48 Antibody [NBP1-59752] - HepG2 cell lysate, concentration 2.5 ug/ml.

Applications for USP48 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: USP48

USP48 is a protein containing domains that associate it with the peptidase family C19, also known as family 2 of ubiquitin carboxyl-terminal hydrolases. Family members function as deubiquitinating enzymes, recognizing and hydrolyzing the peptide bond at the C-terminal glycine of ubiquitin. Enzymes in peptidase family C19 are involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins.

Long Name

Ubiquitin Specific Protease 48

Alternate Names

RAP1GA1, synUSP, USP31

Gene Symbol

USP48

Additional USP48 Products

Product Documents for USP48 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for USP48 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Deubiquitinating Enzymes (DUBs)

Customer Reviews for USP48 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review USP48 Antibody - BSA Free and earn rewards!

Have you used USP48 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies