USP54 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86048

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all USP54 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human USP54. Peptide sequence: TPGPRRVDMPPDDDWRQSSYASHSGHRRTVGEGFLFVLSDAPRREQIRAR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for USP54 Antibody - BSA Free

Western Blot: USP54 Antibody [NBP2-86048]

Western Blot: USP54 Antibody [NBP2-86048]

Western Blot: USP54 Antibody [NBP2-86048] - Host: Rabbit. Target Name: USP54. Sample Type: THP-1 whole cell lysates. Antibody Dilution: 1.0ug/ml
USP54 Antibody - BSA Free

Western Blot: USP54 Antibody - BSA Free [NBP2-86048] -

USP54 deficiency enhances gefitinib-induced EGFR ubiquitination, degradation, and apoptosis in gefitinib-resistant NSCLC cells. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40168312), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
USP54 Antibody - BSA Free

Western Blot: USP54 Antibody - BSA Free [NBP2-86048] -

Differential gene expression analysis in NSCLC cells treated with gefitinib. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40168312), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
USP54 Antibody - BSA Free

Western Blot: USP54 Antibody - BSA Free [NBP2-86048] -

USP54 deficiency enhances gefitinib-induced EGFR ubiquitination, degradation, and apoptosis in gefitinib-resistant NSCLC cells. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40168312), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
USP54 Antibody - BSA Free

Western Blot: USP54 Antibody - BSA Free [NBP2-86048] -

Differential gene expression analysis in NSCLC cells treated with gefitinib. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40168312), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for USP54 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: USP54

Long Name

Inactive ubiquitin carboxyl-terminal hydrolase 54

Alternate Names

C10orf29

Gene Symbol

USP54

Additional USP54 Products

Product Documents for USP54 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for USP54 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for USP54 Antibody - BSA Free

Customer Reviews for USP54 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review USP54 Antibody - BSA Free and earn rewards!

Have you used USP54 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies