V1a Vasopressin R/AVPR1A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84325

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all V1a Vasopressin R/AVPR1A Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of V1a Vasopressin R/AVPR1A. Peptide sequence: WIYMFFSGHLLQDCVQSFPCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for V1a Vasopressin R/AVPR1A Antibody - BSA Free

Western Blot: V1a Vasopressin R/AVPR1A Antibody [NBP2-84325]

Western Blot: V1a Vasopressin R/AVPR1A Antibody [NBP2-84325]

Western Blot: V1a Vasopressin R/AVPR1A Antibody [NBP2-84325] - WB Suggested Anti-AVPR1A Antibody. Titration: 1.0 ug/ml. Positive Control: 293T Whole Cell

Applications for V1a Vasopressin R/AVPR1A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: V1a Vasopressin R/AVPR1A

The protein encoded by the AVPR1A gene acts as receptor for arginine vasopressin. This receptor belongs to the subfamily ofG-protein coupled receptors which includes AVPR1B, V2R and OXT receptors. Its activity is mediated by G proteins whichstimulate a phosphatidylinositol-calcium second messenger system. The receptor mediates cell contraction andproliferation, platelet aggregation, release of coagulation factor and glycogenolysis. (provided by RefSeq)

Long Name

Arginine Vasopressin Receptor 1A

Alternate Names

AVPR V1a, AVPR1A, V1a VasopressinR, V1aR

Gene Symbol

AVPR1A

Additional V1a Vasopressin R/AVPR1A Products

Product Documents for V1a Vasopressin R/AVPR1A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for V1a Vasopressin R/AVPR1A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for V1a Vasopressin R/AVPR1A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review V1a Vasopressin R/AVPR1A Antibody - BSA Free and earn rewards!

Have you used V1a Vasopressin R/AVPR1A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies