Vitronectin Antibody (2V2V8)

Novus Biologicals | Catalog # NBP3-16498

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2V2V8 expressed in HEK293
View all Vitronectin Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 379-478 of human Vitronectin (P04004). YRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Vitronectin Antibody (2V2V8)

Western Blot: Vitronectin Antibody (2V2V8) [NBP3-16498]

Western Blot: Vitronectin Antibody (2V2V8) [NBP3-16498]

Western Blot: Vitronectin Antibody (2V2V8) [NBP3-16498] - Western blot analysis of extracts of HepG2 cells, using Vitronectin Rabbit mAb (NBP3-16498) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Applications for Vitronectin Antibody (2V2V8)

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Vitronectin

Vitronectin also called serum spreading factor or complement S-protein, is a member of the pexin family (1). Found in serum and in tissues, Vitronectin exist in two forms; as a single chain (75kDa) and as a clipped form composed of two chains (65kDa and 10kDa). Vitronectin promotes cell adhesion, spreading and migration through specific interactions with cellular integrins, and inhibits cytolysis by the complement C5b-9 complex (2-4). Vitronectin also interacts with several critical proteins that regulate thrombosis and fibrinolysis. Vitronectin is phosphorylated by PKA and CKII (5).

Alternate Names

Complement S-protein, Serum Spreading Factor, Somatomedin B, VTN

Gene Symbol

VTN

Additional Vitronectin Products

Product Documents for Vitronectin Antibody (2V2V8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Vitronectin Antibody (2V2V8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Extracellular Matrix Molecules

Customer Reviews for Vitronectin Antibody (2V2V8)

There are currently no reviews for this product. Be the first to review Vitronectin Antibody (2V2V8) and earn rewards!

Have you used Vitronectin Antibody (2V2V8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies