VN1R1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09465

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all VN1R1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human VN1R1 (NP_065684). Peptide sequence VQHNHSNRLSCRPSQEARATHTIMVLVSSFFVFYSVHSFLTIWTTVVANP

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for VN1R1 Antibody - BSA Free

Western Blot: VN1R1 Antibody [NBP3-09465]

Western Blot: VN1R1 Antibody [NBP3-09465]

Western Blot: VN1R1 Antibody [NBP3-09465] - Western blot analysis of VN1R1 in COLO205 Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for VN1R1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: VN1R1

VN1R1 is the human homolog of the mouse pheromone receptor V1R. Two single nucleotide polymorphisms have been documented, and they result in amino acid changes (aa 201 S -> F and aa 229 A -> D). VN1R1 expression has been documented in the nasal mucosa. Low levels of expression has also been seen in the brain, lung, and kidney. ESTs have been isolated from brain, lung, and kidney.

Alternate Names

G-protein coupled receptor GPCR24, V1RL1hGPCR24, V1R-like 1, V1r-like receptor 1, V3r-related gene protein, VNR19I1, vomeronasal 1 receptor 1, Vomeronasal olfactory receptor chromosome 19 subtype I member 1, vomeronasal olfactory receptor, (chromosome 19) subtype I, member 1, vomeronasal type-1 receptor 1, ZVNH1, ZVNR1

Gene Symbol

VN1R1

Additional VN1R1 Products

Product Documents for VN1R1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for VN1R1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for VN1R1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review VN1R1 Antibody - BSA Free and earn rewards!

Have you used VN1R1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies