VPS36 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13518

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (94%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all VPS36 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: AGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLSEEMTQRRWENMPVSQSLQTNRG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for VPS36 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: VPS36 Antibody [NBP2-13518]

Immunocytochemistry/ Immunofluorescence: VPS36 Antibody [NBP2-13518]

Immunocytochemistry/Immunofluorescence: VPS36 Antibody [NBP2-13518] - Staining of human cell line U-2 OS shows localization to vesicles & lysosomes.
VPS36 Antibody - BSA Free Immunohistochemistry: VPS36 Antibody - BSA Free [NBP2-13518]

Immunohistochemistry: VPS36 Antibody - BSA Free [NBP2-13518]

Staining of human pancreas shows weak cytoplasmic positivity in exocrine glandular cells.
VPS36 Antibody - BSA Free Immunohistochemistry: VPS36 Antibody - BSA Free [NBP2-13518]

Immunohistochemistry: VPS36 Antibody - BSA Free [NBP2-13518]

Staining of human kidney shows weak cytoplasmic positivity in cells in tubules.
VPS36 Antibody - BSA Free Immunohistochemistry: VPS36 Antibody - BSA Free [NBP2-13518]

Immunohistochemistry: VPS36 Antibody - BSA Free [NBP2-13518]

Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
VPS36 Antibody - BSA Free Immunohistochemistry: VPS36 Antibody - BSA Free [NBP2-13518]

Immunohistochemistry: VPS36 Antibody - BSA Free [NBP2-13518]

Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Applications for VPS36 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: VPS36

Component of the escrt-ii complex, which is required for multivesicular bodies (mvbs) formation and sorting of endosomal cargo proteins into mvbs. the mvb pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. the escrt-ii complex is probably involved in the recruitment of the escrt-iii complex. its ability to bind ubiquitin probably plays a role in endosomal sorting of ubiquitinated cargo proteins by escrt complexes. the escrt-ii complex may also play a role in transcription regulation, possibly via its interaction with ell.

Alternate Names

C13orf9, CGI-145, DKFZp781E0871, Eap45, EAP45chromosome 13 open reading frame 9, ELL-associated protein of 45 kDa, ELL-associated protein, 45 kDa, ESCRT-II complex subunit VPS36, vacuolar protein sorting 36 homolog (S. cerevisiae), vacuolar protein sorting 36 homolog (yeast), vacuolar protein-sorting-associated protein 36

Gene Symbol

VPS36

Additional VPS36 Products

Product Documents for VPS36 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for VPS36 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for VPS36 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review VPS36 Antibody - BSA Free and earn rewards!

Have you used VPS36 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies