WDR46 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP3-25230PEP

Novus Biologicals
100% Guarantee

Key Product Details

Applications

Antibody Competition
View all WDR46 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human WDR46

Source: E.coli

Amino Acid Sequence: LSTRTLPHGAGHLAFSQRGLLVAGMGDVVNIWAGQGKASPPSLEQPYLTHRLSGPVHGLQFCPFEDVLGVGHTGGITSMLV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25230It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP3-25230PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: WDR46

WDR46 was originally identified as BING-4, a protein encoded in a gene-rich region of the major histocompatibility complex (MHC). WDR46 has been found to be overexpressed in a subset of melanoma cell lines and is a cancer antigen recognized by lymphocytes. WDR46 bears six WD repeats. The WD repeat is defined by four or more repeating units of a conserved core of approximately 40 amino acids ending with tryptophan-aspartic acid (WD). WD repeats may serve as sites of protein-protein interaction for adaptor proteins and facilitate multiprotein complex formation. WD proteins are involved in a variety of cellular processes. The function of WDR46 has not been characterized.

Alternate Names

BING4FP221, C6orf11, chromosome 6 open reading frame 11, WD repeat domain 46, WD repeat-containing protein 46, WD repeat-containing protein BING4

Gene Symbol

WDR46

Additional WDR46 Products

Product Documents for WDR46 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for WDR46 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for WDR46 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review WDR46 Recombinant Protein Antigen and earn rewards!

Have you used WDR46 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes