WIPI1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56874

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all WIPI1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to WIPI1(WD repeat domain, phosphoinositide interacting 1) The peptide sequence was selected from the middle region of WIPI1. Peptide sequence LLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for WIPI1 Antibody - BSA Free

Western Blot: WIPI1 Antibody [NBP1-56874]

Western Blot: WIPI1 Antibody [NBP1-56874]

Western Blot: WIPI1 Antibody [NBP1-56874] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: WIPI1 Antibody [NBP1-56874]

Western Blot: WIPI1 Antibody [NBP1-56874]

Western Blot: WIPI1 Antibody [NBP1-56874] - 293T cells lysate, concentration 0.2-1 ug/ml.
Western Blot: WIPI1 Antibody [NBP1-56874]

Western Blot: WIPI1 Antibody [NBP1-56874]

Western Blot: WIPI1 Antibody [NBP1-56874] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Applications for WIPI1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: WIPI1

WD40 repeat proteins are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI su

Alternate Names

Atg18, Atg18 protein homolog, ATG18A, FLJ10055, WD repeat domain phosphoinositide-interacting protein 1, WD repeat domain, phosphoinositide interacting 1, WD40 repeat protein interacting with phosphoinositides of 49 kDa, WD40 repeat protein Interacting with phosphoInositides of 49kDa, WIPI 49 kDa, WIPI-1, WIPI-1 alpha, WIPI49ATG18

Gene Symbol

WIPI1

UniProt

Q5MNZ9 (Human)

Additional WIPI1 Products

Product Documents for WIPI1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for WIPI1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for WIPI1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review WIPI1 Antibody - BSA Free and earn rewards!

Have you used WIPI1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies