WISP3 Antibody - Azide and BSA Free
Novus Biologicals | Catalog # NBP2-93872
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Human, Mouse
Applications
Validated:
Western Blot, ELISA
Cited:
Immunohistochemistry-Paraffin, Western Blot, Immunoprecipitation, Knockdown Validated
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 42-260 of human WISP3 (NP_937882.1). TGPLDTTPEGRPGEVSDAPQRKQFCHWPCKCPQQKPRCPPGVSLVRDGCGCCKICAKQPGEICNEADLCDPHKGLYCDYSVDRPRYETGVCAYLVAVGCEFNQVHYHNGQVFQPNPLFSCLCVSGAIGCTPLFIPKLAGSHCSGAKGGKKSDQSNCSLEPLLQQLSTSYKTMPAYRNLPLIWKKKCLVQATKWTPCSRTCGMGISNRVTNENSNCEMRK
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
Novus Biologicals Rabbit WISP3 Antibody - Azide and BSA Free (NBP2-93872) is a polyclonal antibody validated for use in IHC, WB, ELISA and IP. Anti-WISP3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for WISP3 Antibody - Azide and BSA Free
Western Blot: WISP3 AntibodyAzide and BSA Free [NBP2-93872]
Western Blot: WISP3 Antibody [NBP2-93872] - Analysis of extracts of various cell lines, using WISP3 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.Western Blot: WISP3 Antibody - Azide and BSA Free [NBP2-93872] -
OTUB1 expression is positively correlated with CCN6 in clinical samples. (A) An invasive ductal carcinoma (Grade II, moderately differentiated) sample (T) and the adjacent non‐tumour tissue (N) were analysed with H&E staining and immunohistochemistry for OTUB1 and CCN6 (scale bar = 100 μm). (B) A breast intraductal papilloma sample (T) and the adjacent non‐tumour tissue (N) were analysed with H&E staining and immunohistochemistry for OTUB1 and CCN6 (scale bar = 100 μm). (C) Clinical samples were analysed with Western blot for OTUB1, CCN6 and GAPDH. (D) Correlation between the expression of OTUB1 and CCN6 in tumour tissues (upper panel) and adjacent non‐tumour tissues (lower panel). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37608493), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: WISP3 Antibody - Azide and BSA Free [NBP2-93872] -
OTUB1 inhibits breast cancer growth in vivo. (A) Control, OTUB1−/− and OTUB1−/− + CCN6 4T1 cells were injected into nude mice and tumour volume was measured (n = 6 for all groups) (mean +/- SEM, NC vs. OTUB1−/−: *p <.05, **p <.01; NC vs. OTUB1−/− + CCN6: #p <.05, ##p <.01). On day 9 after tumour inoculation, mice were sacrificed and tumours were collected. Tumour (B) size and (C) weight were measured (n = 6 for all groups) (mean +/- SEM, *p <.05, **p <.01). (D) Whole‐cell lysates of tumour samples were analysed by Western blot for OTUB1, CCN6 and GAPDH. (E) Tumour samples were stained for Ki‐67 and immunoreactivity was detected by 3,3′‐diaminobenzidine chromogen (brown). Sections were counterstained with haematoxylin (blue) (scale bar = 100 μm). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37608493), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: WISP3 Antibody - Azide and BSA Free [NBP2-93872] -
OTUB1 inhibits aggressive phenotypes of breast cancer cells in vitro. (A) Western blot analysis of CCN6, OTUB1 and GAPDH in control, OTUB1−/− and OTUB1−/− + CCN6 4T1 cells. Cell migration of different 4T1 cells was determined by (B) wound healing assay and (C) transwell migration assay (scale bar = 500 μm). Cell proliferation of different 4T1 cells was determined by crystal violet staining. Images were taken with (D) 1× and (E) 4× magnification (scale bar = 500 μm). (F) MTT assays were performed to assess the viability of different 4T1 cells (n = 3 for all groups) (mean +/- SEM, *p <.05). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37608493), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for WISP3 Antibody - Azide and BSA Free
Application
Recommended Usage
Western Blot
1:500-1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
Azide and BSA Free
Preservative
0.01% Thimerosal
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: WISP3
Long Name
Wnt-1 Induced Secreted Protein 3
Alternate Names
CCN6, LIBC, PPAC, PPD, WISP-3
Gene Symbol
CCN6
Additional WISP3 Products
Product Documents for WISP3 Antibody - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for WISP3 Antibody - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.govRelated Research Areas
Citations for WISP3 Antibody - Azide and BSA Free
Customer Reviews for WISP3 Antibody - Azide and BSA Free
There are currently no reviews for this product. Be the first to review WISP3 Antibody - Azide and BSA Free and earn rewards!
Have you used WISP3 Antibody - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...