XLF Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55106

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all XLF Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQEVQVGQKHQGAGDPHTSNSASLQGIDSQCVNQPEQLVSSA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for XLF Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: XLF Antibody [NBP2-55106]

Immunocytochemistry/ Immunofluorescence: XLF Antibody [NBP2-55106]

Immunocytochemistry/Immunofluorescence: XLF Antibody [NBP2-55106] - Staining of human cell line CACO-2 shows localization to nucleus & nucleoli fibrillar center.
XLF Antibody - BSA Free Chromatin Immunoprecipitation ChIP: XLF Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: XLF Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-XLF tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for XLF Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: XLF

Double-strand breaks in DNA result from genotoxic stresses and are among the most damaging of DNA lesions. This gene encodes a DNA repair factor essential for the nonhomologous end-joining pathway, which preferentially mediates repair of double-stranded breaks. Mutations in this gene cause different kinds of severe combined immunodeficiency disorders.

Alternate Names

Cernunnos, non-homologous end-joining factor 1, nonhomologous end-joining factor 1, Protein cernunnos, XLFFLJ12610, XRCC4-like factor

Gene Symbol

NHEJ1

Additional XLF Products

Product Documents for XLF Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for XLF Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for XLF Antibody - BSA Free

There are currently no reviews for this product. Be the first to review XLF Antibody - BSA Free and earn rewards!

Have you used XLF Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies