XPE/DDB2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-68879

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all XPE/DDB2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to DDB2 (damage-specific DNA binding protein 2, 48kDa) The peptide sequence was selected from the C terminal of DDB2. Peptide sequence IVVGRYPDPNFKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEF. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for XPE/DDB2 Antibody - BSA Free

Western Blot: XPE/DDB2 Antibody [NBP1-68879]

Western Blot: XPE/DDB2 Antibody [NBP1-68879]

Western Blot: XPE/DDB2 Antibody [NBP1-68879] - Titration: 0.2-1 ug/ml, Positive Control: Human Placenta.
Western Blot: XPE/DDB2 Antibody [NBP1-68879]

Western Blot: XPE/DDB2 Antibody [NBP1-68879]

Western Blot: XPE/DDB2 Antibody [NBP1-68879] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Applications for XPE/DDB2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: XPE/DDB2

This gene encodes a protein that is necessary for the repair of ultraviolet light-damaged DNA. This protein is the smaller subunit of a heterodimeric protein complex that participates in nucleotide excision repair, and this complex mediates the ubiquitylation of histones H3 and H4, which facilitates the cellular response to DNA damage. This subunit appears to be required for DNA binding. Mutations in this gene cause xeroderma pigmentosum complementation group E, a recessive disease that is characterized by an increased sensitivity to UV light and a high predisposition for skin cancer development, in some cases accompanied by neurological abnormalities.

Long Name

Xeroderma Pigmentosum E

Alternate Names

DDB2, XP5

Gene Symbol

DDB2

UniProt

Q92466

Additional XPE/DDB2 Products

Product Documents for XPE/DDB2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for XPE/DDB2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for XPE/DDB2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review XPE/DDB2 Antibody - BSA Free and earn rewards!

Have you used XPE/DDB2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies