Recombinant Human ZAK GST (N-Term) Protein

Novus Biologicals | Catalog # H00051776-P01

Novus Biologicals
100% Guarantee

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Enzyme Activity, Microarray
View all ZAK Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-455 of Human ZAK

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVLSHRNIIQFYGVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRFHNHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKKLERDLSFKEQELKERERRLKMWEQKLTEQSNTPLLLPLAARMSEESYFESKTEESNSAEMSCQITATSNGEGHGMNPSLQAMMLMGFGDIFSMNKAGAVMHSGMQINMQAKQNSSKTTSKRRGKKVNMALGFSDFDLSEGDDDDDDDGEEEDNDMDNSE

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

75.79 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human ZAK GST (N-Term) Protein

SDS-PAGE: Recombinant Human ZAK GST (N-Term) Protein [H00051776-P01]

SDS-PAGE: Recombinant Human ZAK GST (N-Term) Protein [H00051776-P01]

SDS-Page: ZAK Recombinant Protein [H00051776-P01]
Functional: Recombinant Human ZAK Protein [H00051776-P01]

Formulation, Preparation, and Storage

H00051776-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: ZAK

ZAK( AAH01401, 1 a.a. - 456 a.a.) recombinant protein with GST.

Alternate Names

AZK, EC 2.7.11, EC 2.7.11.25, HCCS-4, Human cervical cancer suppressor gene 4 protein, Leucine zipper- and sterile alpha motif-containing kinase, mitogen-activated protein kinase kinase kinase MLT, mixed lineage kinase 7, mixed lineage kinase with a leucine zipper and a sterile alpha motif, Mixed lineage kinase-related kinase, mixed lineage kinase-related kinase MRK-beta, MLK7, mlklak, MLK-like mitogen-activated protein triple kinase, MLK-related kinase, MLT, MLTK, MRKcervical cancer suppressor gene 4 protein, pk, protein kinase, sterile alpha motif and leucine zipper containing kinase AZK, Sterile alpha motif- and leucine zipper-containing kinase AZK

Gene Symbol

ZAK

Additional ZAK Products

Product Documents for Recombinant Human ZAK GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human ZAK GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human ZAK GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human ZAK GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human ZAK GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes