ZFP91 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55792

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SALPQEVSIAASRPSRGWRSSRTSVSRHRDTENTRSSRSKTGSLQLICKSEPNTDQLDYDV

Reactivity Notes

Rat 82%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ZFP91 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ZFP91 Antibody [NBP2-55792]

Immunocytochemistry/ Immunofluorescence: ZFP91 Antibody [NBP2-55792]

Immunocytochemistry/Immunofluorescence: ZFP91 Antibody [NBP2-55792] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
ZFP91 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: ZFP91 Antibody - BSA Free [NBP2-55792]

Chromatin Immunoprecipitation-exo-Seq: ZFP91 Antibody - BSA Free [NBP2-55792]

ChIP-Exo-Seq composite graph for Anti-ZFP91 (NBP2-55792) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for ZFP91 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZFP91

The protein encoded by the ZFP91 gene is a member of the zinc finger family of proteins. The gene product contains C2H2 typedomains, which are the classical zinc finger domains found in numerous nucleic acid-binding proteins. A read-throughtranscript variant composed of ZFP91 and CNTF sequence has been identified, but it is thought to be non-coding.Read-through transcription of ZFP91 and CNTF has also been observed in mouse. A pseudogene has also been identified onchromosome 2. (provided by RefSeq)

Alternate Names

FLJ57065, ZFP-91, zinc finger protein 91 homolog (mouse), zinc finger protein homologous to Zfp91 in mouse

Gene Symbol

ZFP91

Additional ZFP91 Products

Product Documents for ZFP91 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZFP91 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZFP91 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZFP91 Antibody - BSA Free and earn rewards!

Have you used ZFP91 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...