ZFP91 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP3-25242PEP

Novus Biologicals
100% Guarantee

Key Product Details

Applications

Antibody Competition
View all ZFP91 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZFP91

Source: E.coli

Amino Acid Sequence: YCSGTERVSLMADGKIFVGSGSSGGTEGLVMNSDILGATTEVLIEDSDSAGP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25242It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP3-25242PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: ZFP91

The protein encoded by the ZFP91 gene is a member of the zinc finger family of proteins. The gene product contains C2H2 typedomains, which are the classical zinc finger domains found in numerous nucleic acid-binding proteins. A read-throughtranscript variant composed of ZFP91 and CNTF sequence has been identified, but it is thought to be non-coding.Read-through transcription of ZFP91 and CNTF has also been observed in mouse. A pseudogene has also been identified onchromosome 2. (provided by RefSeq)

Alternate Names

FLJ57065, ZFP-91, zinc finger protein 91 homolog (mouse), zinc finger protein homologous to Zfp91 in mouse

Gene Symbol

ZFP91

Additional ZFP91 Products

Product Documents for ZFP91 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZFP91 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for ZFP91 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review ZFP91 Recombinant Protein Antigen and earn rewards!

Have you used ZFP91 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes