ZNF148 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88645

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF148. Peptide sequence: QHSFPFSGDETNHASATSTQDFLDQVTSQKKAEAQPVHQAYQMSSFEQPF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ZNF148 Antibody - BSA Free

Western Blot: ZNF148 Antibody [NBP2-88645]

Western Blot: ZNF148 Antibody [NBP2-88645]

Western Blot: ZNF148 Antibody [NBP2-88645] - WB Suggested Anti-ZNF148 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: Human Placenta

Applications for ZNF148 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZNF148

ZBP-89, also known as BFCOL1, BERF1 and ZNF 148, is a zinc finger transcription factor that is universally expressed. ZBP-89, a Kruppel-like repressor protein, is the silencer element binding factor for Vimentin. ZBP-89 has been shown to bind to GC-rich DNA elements in promoters for gastrin, ornithine decarboxylase and the cyclin-dependent kinase inhibitor p21 (also designated Cip1 or WAF1). ZBP-89 expression is induced by trans-retinoic acid or butyrate, which also induces terminal differentiation of colon cancer cells. ZBP-89 cooperates with histone acetyltransferase coactivator p300 in the regulation of p21, a cyclin-dependent kinase inhibitor whose associated gene is a target gene of p53. ZBP-89 also regulates cell proliferation, in part, through its ability to directly bind the p53 protein and retard its nuclear export. Elevated levels of ZBP-89 induce growth arrest and apoptosis in human gastrointestinal cells.

Alternate Names

BERF-1, BFCOL1, CACCC box-binding protein, CLL-associated antigen KW-10, HT-BETA, pHZ-52, Transcription factor ZBP-89, ZBP89, ZBP-89, ZFP148zinc finger protein 148 (pHZ-52), Zinc finger DNA-binding protein 89, zinc finger protein 148

Gene Symbol

ZNF148

Additional ZNF148 Products

Product Documents for ZNF148 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZNF148 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZNF148 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZNF148 Antibody - BSA Free and earn rewards!

Have you used ZNF148 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...