ZNF638 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56119

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ZNF638 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EPIKSVNQSINQTVSQTMSQSLIPPSMNQQPFSSELISSVSQQERIPHEPVINSSNVHVGSRGSKKNYQSQADIPIRSPFGIVKASWLPKF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ZNF638 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ZNF638 Antibody [NBP2-56119]

Immunocytochemistry/ Immunofluorescence: ZNF638 Antibody [NBP2-56119]

Immunocytochemistry/Immunofluorescence: ZNF638 Antibody [NBP2-56119] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.
ZNF638 Antibody - BSA Free Chromatin Immunoprecipitation ChIP: ZNF638 Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: ZNF638 Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-ZNF638 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for ZNF638 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZNF638

ZNF638 is encoded by this gene is a nucleoplasmic protein. It binds cytidine-rich sequences in double-stranded DNA. This protein has three types of domains: MH1, MH2 (repeated three times) and MH3. It is associated with packaging, transferring, or processing transcripts. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined.

Alternate Names

CTCL tumor antigen se33-1, CTCL-associated antigen se33-1, Cutaneous T-cell lymphoma-associated antigen se33-1, DKFZp686P1231, MGC26130, MGC90196, NP220 nuclear protein, NP220zinc finger, matrin-like, Nuclear protein 220, ZFML, Zfp638, Zinc finger matrin-like protein, zinc finger protein 638

Gene Symbol

ZNF638

Additional ZNF638 Products

Product Documents for ZNF638 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ZNF638 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZNF638 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZNF638 Antibody - BSA Free and earn rewards!

Have you used ZNF638 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies