ZNF650 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88717

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ZNF650 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human ZNF650. Peptide sequence: SQNCGAGTGIFLLINASVIIIIRGHRFCLWGSVYLDAHGEEDRDLRRGKP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ZNF650 Antibody - BSA Free

Western Blot: ZNF650 Antibody [NBP2-88717]

Western Blot: ZNF650 Antibody [NBP2-88717]

Western Blot: ZNF650 Antibody [NBP2-88717] - Host: Rabbit. Target Name: UBR3. Sample Tissue: Human Jurkat Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for ZNF650 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZNF650

E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Does not bind to proteins bearingspecific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination andsubsequent degradation

Alternate Names

DKFZp434P117, E3 ubiquitin-protein ligase UBR3, EC 6.3.2.-, FLJ37422, KIAA2024DKFZp686N10185, MGC126489, N-recognin-3, ubiquitin protein ligase E3 component n-recognin 3 (putative), Ubiquitin-protein ligase E3-alpha-3, Ubiquitin-protein ligase E3-alpha-III, Zinc finger protein 650ZNF650

Gene Symbol

UBR3

Additional ZNF650 Products

Product Documents for ZNF650 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZNF650 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZNF650 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZNF650 Antibody - BSA Free and earn rewards!

Have you used ZNF650 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies