alcohol dehydrogenase Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35880

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all alcohol dehydrogenase Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 270-370 of human alcohol dehydrogenase (NP_000659.2).

Sequence:
LLCCHEACGTSVIVGVPPASQNLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHVLPFEKINEGFDLLHSGKSIRTVLTF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for alcohol dehydrogenase Antibody - BSA Free

alcohol dehydrogenase Antibody

Immunocytochemistry/ Immunofluorescence: alcohol dehydrogenase Antibody [NBP3-35880] -

Immunocytochemistry/ Immunofluorescence: alcohol dehydrogenase Antibody [NBP3-35880] - Immunofluorescence analysis of paraffin-embedded Mouse liver using alcohol dehydrogenase Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
alcohol dehydrogenase Antibody

Western Blot: alcohol dehydrogenase Antibody [NBP3-35880] -

Western Blot: alcohol dehydrogenase Antibody [NBP3-35880] - Western blot analysis of lysates from Mouse lung, using alcohol dehydrogenase Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
alcohol dehydrogenase Antibody

Immunocytochemistry/ Immunofluorescence: alcohol dehydrogenase Antibody [NBP3-35880] -

Immunocytochemistry/ Immunofluorescence: alcohol dehydrogenase Antibody [NBP3-35880] - Immunofluorescence analysis of paraffin-embedded Rat liver using alcohol dehydrogenase Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
alcohol dehydrogenase Antibody

Immunocytochemistry/ Immunofluorescence: alcohol dehydrogenase Antibody [NBP3-35880] -

Immunocytochemistry/ Immunofluorescence: alcohol dehydrogenase Antibody [NBP3-35880] - Immunofluorescence analysis of paraffin-embedded Human liver using alcohol dehydrogenase Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for alcohol dehydrogenase Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL.

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: alcohol dehydrogenase

ADH (alcohol dehydrogenase) family of proteins metabolize a variety of substances such as ethanol, retinal, other aliphatic alcohol, hydroxysteroids, and lipid peroxidation products. With the coenzyme NAD, ADH catalyzes the reversible conversion of organic alcohol to ketones or aldehydes. ADH play a major role in ethanol metabolism.

Alternate Names

ADH, alpha subunit, ADH1alcohol dehydrogenase 1A, alcohol dehydrogenase 1 (class I), alpha polypeptide, alcohol dehydrogenase 1A (class I), alpha polypeptide, Alcohol dehydrogenase subunit alpha, aldehyde reductase, EC 1.1.1, EC 1.1.1.1

Gene Symbol

ADH1A

Additional alcohol dehydrogenase Products

Product Documents for alcohol dehydrogenase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for alcohol dehydrogenase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for alcohol dehydrogenase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review alcohol dehydrogenase Antibody - BSA Free and earn rewards!

Have you used alcohol dehydrogenase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies