ARL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35519

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 62-181 of human ARL1 (NP_001168.1).

Sequence:
KFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ARL1 Antibody - BSA Free

ARL1 Antibody

Western Blot: ARL1 Antibody [NBP3-35519] -

Western Blot: ARL1 Antibody [NBP3-35519] - Western blot analysis of various lysates using ARL1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 3min.
ARL1 Antibody

Immunocytochemistry/ Immunofluorescence: ARL1 Antibody [NBP3-35519] -

Immunocytochemistry/ Immunofluorescence: ARL1 Antibody [NBP3-35519] - Immunofluorescence analysis of C6 cells using ARL1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
ARL1 Antibody

Immunocytochemistry/ Immunofluorescence: ARL1 Antibody [NBP3-35519] -

Immunocytochemistry/ Immunofluorescence: ARL1 Antibody [NBP3-35519] - Immunofluorescence analysis of L929 cells using ARL1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for ARL1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:200 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ARL1

ARL1, or ADP-ribosylation factor-like protein 1, consists of a 181 amino acid isoform that is 20 kDa, and is involved in the stimulation of PLD and CT and the regular function of the Golgi apparatus. Research is currently being conducted on ARL1 and its relation to cholera, melanoma, and malaria. The protein has been linked to the GTP catabolic and toxin metabolic processes, within which it interacts with GOLGA1, GOLGA4, MYC, ARFIP2, and C20orf24.

Alternate Names

ADP-ribosylation factor-like 1, ADP-ribosylation factor-like protein 1, ARFL1

Gene Symbol

ARL1

Additional ARL1 Products

Product Documents for ARL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ARL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ARL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ARL1 Antibody - BSA Free and earn rewards!

Have you used ARL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...