Atlastin-2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35616

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 390-470 of human Atlastin-2 (NP_001129145.1).

Sequence:
ARDTYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

66 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Atlastin-2 Antibody - BSA Free

Atlastin-2 Antibody

Immunocytochemistry/ Immunofluorescence: Atlastin-2 Antibody [NBP3-35616] -

Immunocytochemistry/ Immunofluorescence: Atlastin-2 Antibody [NBP3-35616] - Immunofluorescence analysis of HeLa cells using Atlastin-2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Atlastin-2 Antibody

Immunocytochemistry/ Immunofluorescence: Atlastin-2 Antibody [NBP3-35616] -

Immunocytochemistry/ Immunofluorescence: Atlastin-2 Antibody [NBP3-35616] - Immunofluorescence analysis of C6 cells using Atlastin-2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Atlastin-2 Antibody

Western Blot: Atlastin-2 Antibody [NBP3-35616] -

Western Blot: Atlastin-2 Antibody [NBP3-35616] - Western blot analysis of lysates from HepG2 cells, using Atlastin-2 Rabbit pAb at 1:800 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 20s.
Atlastin-2 Antibody

Immunocytochemistry/ Immunofluorescence: Atlastin-2 Antibody [NBP3-35616] -

Immunocytochemistry/ Immunofluorescence: Atlastin-2 Antibody [NBP3-35616] - Immunofluorescence analysis of L929 cells using Atlastin-2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Atlastin-2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Atlastin-2

GTPase tethering membranes through formation of trans-homooligomer and mediating homotypic fusion ofendoplasmic reticulum membranes. Functions in endoplasmic reticulum tubular network biogenesis

Alternate Names

ADP-ribosylation factor-like 6 interacting protein 2, ADP-ribosylation factor-like protein 6-interacting protein 2, ADP-ribosylation-like factor 6 interacting protein 2, aip-2, ARL3IP2, ARL-6-interacting protein 2, ARL6IP2, atlastin GTPase 2, atlastin2, atlastin-2, EC 3.6.5.-, FLJ23293

Gene Symbol

ATL2

Additional Atlastin-2 Products

Product Documents for Atlastin-2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Atlastin-2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Atlastin-2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Atlastin-2 Antibody - BSA Free and earn rewards!

Have you used Atlastin-2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...