ATP6V1A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55164

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQT

Reactivity Notes

Canine reactivity reported from a verified customer review.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ATP6V1A Antibody - BSA Free

Western Blot: ATP6V1A Antibody [NBP2-55164]

Western Blot: ATP6V1A Antibody [NBP2-55164]

Western Blot: ATP6V1A Antibody [NBP2-55164] - ATP6V1A levels in MDCK lysates probed by western blot. Rabbit anti-ATP6V1A (NBP2-55164) primary antibody was used at 1:1000 dilution overnight at 4C. Image from verified customer review.
Western Blot: ATP6V1A Antibody [NBP2-55164]

Western Blot: ATP6V1A Antibody [NBP2-55164]

Western Blot: ATP6V1A Antibody [NBP2-55164] - Analysis using Anti-ATP6V1A antibody NBP2-55164 (A) shows similar pattern to independent antibody NBP2-55148 (B).
ATP6V1A Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: ATP6V1A Antibody [NBP2-55164]

Immunocytochemistry/ Immunofluorescence: ATP6V1A Antibody [NBP2-55164]

Staining of human cell line U-2 OS shows localization to nucleus, cytosol & vesicles.

Applications for ATP6V1A Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 4 using NBP2-55164 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATP6V1A

ATP6V1A encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of two V1 domain A subunit isoforms and is found in all tissues. Transcript variants derived from alternative polyadenylation exist. [provided by RefSeq]

Long Name

V-type proton ATPase catalytic subunit A

Alternate Names

ATP6A1, ATP6V1A1, EC 7.1.2.2, V-ATPase subunit A, VPP2

Gene Symbol

ATP6V1A

Additional ATP6V1A Products

Product Documents for ATP6V1A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ATP6V1A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ATP6V1A Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used ATP6V1A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 1 的 1 review Showing All
Filter By:
  • ATP6V1A Antibody
    Name: Huxley Hoffman
    Application: Western Blot
    Sample Tested: MDCK canine kidney epithelial cell line
    Species: Canine
    Verified Customer | Posted 09/01/2022
    ATP6V1A levels in MDCK lysates probed by western blot. Rabbit anti-ATP6V1A (NBP2-55164) primary antibody was used at 1:1000 dilution overnight at 4C.
    ATP6V1A Antibody - BSA Free NBP2-55164
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 1 的 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...