ATPase Inhibitory Factor 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-92891

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ATPase Inhibitory Factor 1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 26-106 of human ATPIF1 (NP_057395.1). GSDQSENVDRGAGSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIERLQKEIERHKQKIKMLKHDD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ATPase Inhibitory Factor 1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ATPase Inhibitory Factor 1 Antibody - BSA Free [NBP2-92891]

Immunocytochemistry/ Immunofluorescence: ATPase Inhibitory Factor 1 Antibody - BSA Free [NBP2-92891]

Immunocytochemistry/Immunofluorescence: ATPase Inhibitory Factor 1 Antibody [NBP2-92891] - Analysis of U2OS cells using ATPase Inhibitory Factor 1 at dilution of 1:100. Blue: DAPI for nuclear staining.
ATPase Inhibitory Factor 1 Antibody - BSA Free

Immunoprecipitation: ATPase Inhibitory Factor 1 Antibody - BSA Free [NBP2-92891] -

Immunoprecipitation: ATPase Inhibitory Factor 1 Antibody - BSA Free [NBP2-92891] - Immunoprecipitation analysis of 300 ug extracts of K-562 cells using 3 ug [KO Validated] ATPase Inhibitory Factor 1 Rabbit pAb. Western blot was performed from the immunoprecipitate using [KO Validated] ATPase Inhibitory Factor 1 Rabbit pAb at a dilition of 1:3000.
ATPase Inhibitory Factor 1 Antibody - BSA Free

Western Blot: ATPase Inhibitory Factor 1 Antibody - BSA Free [NBP2-92891] -

Western Blot: ATPase Inhibitory Factor 1 Antibody - BSA Free [NBP2-92891] - Western blot analysis of lysates from wild type(WT) and ATPase Inhibitory Factor 1 knockout (KO) 293T(KO) cells, using [KO Validated] ATPase Inhibitory Factor 1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.

Applications for ATPase Inhibitory Factor 1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:100

Immunoprecipitation

1:1000 - 1:5000

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ATPase Inhibitory Factor 1

ATPase Inhibitory Factor 1 encodes a mitochondrial ATPase inhibitor. Alternative splicing occurs at this locus and three transcript variants encoding distinct isoforms have been identified.

Alternate Names

ATP synthase inhibitor protein, ATPase inhibitor protein, ATPase inhibitor, mitochondrial, ATPase inhibitory factor 1, ATPIIF(1), ATPIP, IF1, Inhibitor of F(1)F(o)-ATPase, IP, MGC1167, MGC8898

Gene Symbol

ATP5IF1

Additional ATPase Inhibitory Factor 1 Products

Product Documents for ATPase Inhibitory Factor 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ATPase Inhibitory Factor 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ATPase Inhibitory Factor 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ATPase Inhibitory Factor 1 Antibody - BSA Free and earn rewards!

Have you used ATPase Inhibitory Factor 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies